[KD Validated] MRPS7 Rabbit polyclonal antibody

Größe

Auf Anfrage

SKU:: A24774
Zusätzliche Namen:: bMRP27a|mitochondrial ribosomal protein S7|MRP-S|MRP-S7|MRPS7|RP-S7|RPMS7|S7mt
Anwendung:: ELISA, WB
Molekulargewicht:: 28kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: EFKDPLIDKEYYRKPVEELTEEEKYVRELKKTQLIKAAPAGKTSSVFEDPVISKFTNMMMIGGNKVLARSLMIQTLEAVKRKQFEKYHAASAEEQATIERN
Uniprot:: Q9Y2R9
Synonyme:: 28S ribosomal protein S7, mitochondrial;30S ribosomal protein S7 homolog;bMRP-27a;bMRP27a;COXPD34;mitochondrial small ribosomal subunit protein uS7m;MRP-S;MRP-S7;RP-S7;RPMS7;S7mt
Weitere Details:: Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein. In the prokaryotic ribosome, the comparable protein is thought to play an essential role in organizing the 3' domain of the 16 S rRNA in the vicinity of the P- and A-sites. Pseudogenes corresponding to this gene are found on chromosomes 8p and 12p.

Versandbedingungen:: Blue Ice