MRPS36 Rabbit polyclonal antibody

Größe

Auf Anfrage

SKU:: A24757
Zusätzliche Namen:: DC47|mitochondrial ribosomal protein S36|MRP-S36|MRPS36
Anwendung:: ELISA, WB, IHC-P
Molekulargewicht:: 14kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MMGSKMASASRVVQVVKPHTPLIRFPDRRDNPKPNVSEALRSAGLPSHSSVISQHSKGSKSPDLLMYQGPPDTAEIIKTLPQKYRRKLVSQEEMEFIQRGGPE
Uniprot:: P82909
Synonyme:: 28S ribosomal protein S12, mitochondrial;28S ribosomal protein S36, mitochondrial;alpha-ketoglutarate dehydrogenase component 4;DC47;mitochondrial small ribosomal subunit protein uS12m;MPR-S12;MRP-S12;MRP-S36;MT-RPS12;RPMS12;RPS12;RPSM12;S12mt;S36mt
Weitere Details:: Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. The mitochondrial ribosome (mitoribosome) consists of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein. Pseudogenes corresponding to this gene are found on chromosomes 3p, 4q, 8p, 11q, 12q, and 20p.

Versandbedingungen:: Blue Ice