A24732
PCPE-1 Rabbit monoclonal antibody
Größe
Auf Anfrage
- SKU:
- A24732
- Zusätzliche Namen:
- PCPE|PCPE-1|PCPE1
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 48 kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- EKTEESPSAPDAPTCPKQCRRTGTLQSNFCASSLVVTATVKSMVREPGEGLAVTVSLIGAYKTGGLDLPSPPTGASLKFYVPCKQCPPMKKGVSYLLMGQVEENRGPVLPPESFVVLHRPNQDQILTNLSKRKCPSQPVRAAASQD
- Uniprot:
- Q15113
- Synonyme:
- PCPE;PCPE-1;PCPE1;procollagen C-endopeptidase enhancer 1;procollagen C-proteinase enhancer 1;procollagen COOH-terminal proteinase enhancer 1;procollagen, type 1, COOH-terminal proteinase enhancer;type 1 procollagen C-proteinase enhancer protein;type I procollagen COOH-terminal proteinase enhancer
- Weitere Details:
- Fibrillar collagen types I-III are synthesized as precursor molecules known as procollagens. These precursors contain amino- and carboxyl-terminal peptide extensions known as N- and C-propeptides, respectively, which are cleaved, upon secretion of procollagen from the cell, to yield the mature triple helical, highly structured fibrils. This gene encodes a glycoprotein which binds and drives the enzymatic cleavage of type I procollagen and heightens C-proteinase activity.
- Versandbedingungen:
- Blue Ice