DR4 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A24703
Zusätzliche Namen:: APO2|CD261|DR4|TNF receptor superfamily member 10a|TNFRSF10A|TRAILR-1|TRAILR1
Anwendung:: ELISA, Flow Cytometry
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: EHSPLGELCPPGSHRSEHPGACNRCTEGVGYTNASNNLFACLPCTACKSDEEERSPCTTTRNTACQCKPGTFRNDNSAEMCRKCSRGCPRGMVKVKDCTPWSDIECVHK
Uniprot:: O00220
Synonyme:: APO2;CD261;cytotoxic TRAIL receptor;death receptor 4;DR4;TNF-related apoptosis-inducing ligand receptor 1;TRAIL receptor 1;TRAIL-R1;TRAILR-1;TRAILR1;tumor necrosis factor receptor superfamily member 10A;tumor necrosis factor receptor superfamily member 10a variant 2;tumor necrosis factor receptor superfamily, member 10a
Weitere Details:: The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor is activated by tumor necrosis factor-related apoptosis inducing ligand (TNFSF10/TRAIL), and thus transduces cell death signal and induces cell apoptosis. Studies with FADD-deficient mice suggested that FADD, a death domain containing adaptor protein, is required for the apoptosis mediated by this protein.