ABflo[R] 594 Rabbit anti-Human CD35 monoclonal antibody

Größe

Auf Anfrage

SKU:: A24699
Zusätzliche Namen:: C3BR|C4BR|CD35|complement receptor type 1|CR1|KN
Anwendung:: Flow Cytometry
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: 2-8[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: DPHPDRGTSFDLIGESTIRCTSDPQGNGVWSSPAPRCGILGHCQAPDHFLFAKLKTQTNASDFPIGTSLKYECRPEYYGRPFSITCLDNLVWSSPKDVCKRKSCKTPPDPVNGMVHVITDIQVGSRINYSCTTGHRLIGHSSAECILSGNTAHWSTKPPICQRIPCGLPPTIANGDFISTNRENFHYGSVVTYRC
Uniprot:: P17927
Synonyme:: C3-binding protein;C3b/C4b receptor;C3BR;C4BR;CD35;CD35 antigen;complement component (3b/4b) receptor 1 (Knops blood group);complement receptor 1;complement receptor type 1;KN;Knops blood group antigen
Weitere Details:: Complement receptor type 1 (CR1/CD35) is a type I transmembrane glycoprotein that is expressed on the surface of B cells, neutrophils, monocytes, and renal podocytes. As a component of the host's innate immune system, CR1/CD35 expressed on neutrophils and monocytes binds to ligands coated with complement opsonins C3b and C4b, thereby promoting phagocytosis and pro-inflammatory cytokine production. CR1/CD35 also participates in negative regulation of the complement cascade through its ability to promote dissociation of C3 and C5 convertases and by serving as one of multiple cofactors for factor-I-mediated cleavage and inactivation of C3b and C4b.

Versandbedingungen:: Blue Ice