ABflo[R] 488 Rabbit anti-Human CD75 monoclonal antibody

Größe

Auf Anfrage

SKU:: A24683
Zusätzliche Namen:: CDw75|SIAT1|ST6GalI|ST6N
Anwendung:: Flow Cytometry
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: 2-8[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: EFQVLKSLGKLAMGSDSQSVSSSSTQDPHRGRQTLGSLRGLAKAKPEASFQVWNKDSSSKNLIPRLQKIWKNYLSMNKYKVSYKGPGPGIKFSAEALRCHLRDHVNVSMVEVTDFPFNTSEWEGYLPKESIRTKAGPWGRCAVVSSAGSLKSSQLGREIDDHDAVLRFNGAPTANFQQDVGTKTTIRLMNSQLVTTEKRFLKDSLYNEGILIVWDPSVYHSDIPKWYQNPDYNFFNNYKTYRKLHPNQPFYILKPQMPWELWDILQEISPEEIQPNPPSSGMLGIIIMMTLCDQVDIYEFLPSKRKTDVCYYYQKFFDSACTMGAYHPLLYEKNLVKHLNQGTDEDIYLLGKATLPGFRTIHC
Uniprot:: P15907
Synonyme:: alpha 2,6-ST 1;B-cell antigen CD75;beta-galactoside alpha-2,6-sialyltransferase 1;CMP-N-acetylneuraminate beta-galactosamide alpha-2,6-sialyltransferase;CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,6-sialyltransferase 1;Sialyltransferase 1;sialyltransferase 1 (beta-galactoside alpha-2,6-sialyltransferase);SIAT1;ST6 beta-galactosamide alpha-2,6-sialyltranferase 1;ST6 N-acetylgalactosaminide alpha-2,6-sialyltransferase 1;ST6Gal I;ST6GalI;ST6N
Weitere Details:: This gene encodes a member of glycosyltransferase family 29. The encoded protein is a type II membrane protein that catalyzes the transfer of sialic acid from CMP-sialic acid to galactose-containing substrates. The protein, which is normally found in the Golgi but can be proteolytically processed to a soluble form, is involved in the generation of the cell-surface carbohydrate determinants and differentiation antigens HB-6, CD75, and CD76. This gene has been incorrectly referred to as CD75. Alternative splicing results in multiple transcript variants.

Versandbedingungen:: Blue Ice