MKP1 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A24667
Zusätzliche Namen:: CL100|HVH1|MKP-1|MKP1|PTPN10
Anwendung:: ELISA, WB
Molekulargewicht:: 40kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: TICLAYLMRTNRVKLDEAFEFVKQRRSIISPNFSFMGQLLQFESQVLAPHCSAEAGSPAMAVLDRGTSTTTVFNFPVSIPVHSTNSALSYLQSPITTSPSC
Uniprot:: P28562
Synonyme:: CL 100;CL100;dual specificity protein phosphatase 1;dual specificity protein phosphatase hVH1;HVH1;MAP kinase phosphatase 1;mitogen-activated protein kinase phosphatase 1;MKP-1;MKP1;protein-tyrosine phosphatase CL100;PTPN10;serine/threonine specific protein phosphatase
Weitere Details:: The protein encoded by this gene is a phosphatase with dual specificity for tyrosine and threonine. The encoded protein can dephosphorylate MAP kinase MAPK1/ERK2, which results in its involvement in several cellular processes. This protein appears to play an important role in the human cellular response to environmental stress as well as in the negative regulation of cellular proliferation. Finally, the encoded protein can make some solid tumors resistant to both chemotherapy and radiotherapy, making it a target for cancer therapy.