A24663
CD99 Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A24663
- Zusätzliche Namen:
- CD99|HBA71|MIC2|MIC2X|MIC2Y|MSK5X
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 32kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- DGGFDLSDALPDNENKKPTAIPKKPSAGDDFDLGDAVVDGENDDPRPPNPPKPMPNPNPNHPSSSGSFSDADLADGVSGGEGKGGSDGGGSHRKEGEEADAP
- Uniprot:
- P14209
- Synonyme:
- 12E7;antigen identified by monoclonal 12E7, Y homolog;antigen identified by monoclonal antibodies 12E7, F21 and O13;CD99 antigen;cell surface antigen 12E7;cell surface antigen HBA-71;cell surface antigen O13;E2 antigen;HBA71;MIC2;MIC2 (monoclonal antibody 12E7);MIC2X;MIC2Y;MSK5X;Protein MIC2;surface antigen MIC2;T-cell surface glycoprotein E2
- Weitere Details:
- The protein encoded by this gene is a cell surface glycoprotein involved in leukocyte migration, T-cell adhesion, ganglioside GM1 and transmembrane protein transport, and T-cell death by a caspase-independent pathway. In addition, the encoded protein may have the ability to rearrange the actin cytoskeleton and may also act as an oncosuppressor in osteosarcoma. This gene is found in the pseudoautosomal region of chromosomes X and Y and escapes X-chromosome inactivation. There is a related pseudogene located immediately adjacent to this locus.
- Versandbedingungen:
- Blue Ice

