A24657
DVL1 Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A24657
- Zusätzliche Namen:
- DRS2|DVL|DVL1|DVL1L1|DVL1P1
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 85kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Mouse
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- DEEETPYLVKLPVAPERVTLADFKNVLSNRPVHAYKFFFKSMDQDFGVVKEEIFDDNAKLPCFNGRVVSWLVLAEGAHSDAGSQGTDSHTDLPPPLERTG
- Uniprot:
- O14640
- Synonyme:
- dishevelled 1 (homologous to Drosophila dsh);dishevelled-1;dishevelled, dsh homolog 1;DRS2;DSH homolog 1;DVL;DVL1L1;DVL1P1;segment polarity protein dishevelled homolog DVL-1
- Weitere Details:
- DVL1, the human homolog of the Drosophila dishevelled gene (dsh) encodes a cytoplasmic phosphoprotein that regulates cell proliferation, acting as a transducer molecule for developmental processes, including segmentation and neuroblast specification. DVL1 is a candidate gene for neuroblastomatous transformation. The Schwartz-Jampel syndrome and Charcot-Marie-Tooth disease type 2A have been mapped to the same region as DVL1. The phenotypes of these diseases may be consistent with defects which might be expected from aberrant expression of a DVL gene during development.
- Versandbedingungen:
- Blue Ice

