Human IgG4/Immunoglobulin heavy constant gamma 4 Rabbit polyclonal antibody

Größe

Auf Anfrage

SKU:: A24655
Zusätzliche Namen:: Human IgG4/Immunoglobulin heavy constant gamma 4|Ig gamma-4 chain C region|IGHG4
Anwendung:: ELISA, WB
Molekulargewicht:: 36kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: VHTFPAVLQSSGLYSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVESKYGPPCPSCPAPEFLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQED
Uniprot:: P01861
Synonyme:: Ig gamma-4 chain C region
Weitere Details:: Immunoglobulin G (IgG), is one of the most abundant protein in human serum with normal levels between 8-17 mg/ml in adult blood. IgG is important for our defence against microorganisms and the molecules are produced by B-lymphocytes as a part of our adaptive immune response. The IgG molecule has two separate functions; to bind to the pathogen that elicited the response and to recruit other cells and molecules to destroy the antigen. The variability of the IgG pool is generated by somatic recombination and the number of specificities in an individual at a given time point is estimated to be 1011 variants.