ABflo[R] 647 Rabbit anti-Human T-bet/Tbx21 monoclonal antibody

Größe

£135.75

War £181.00

SKU:: A24573
Zusätzliche Namen:: T-bet|T-box 21|T-PET|TBET|TBLYM|TBX21
Anwendung:: Flow Cytometry
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: 2-8[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: KGFRENFESMYTSVDTSIPSPPGPNCQFLGGDHYSPLLPNQYPVPSRFYPDLPGQAKDVVPQAYWLGAPRDHSYEAEFRAVSMKPAFLPSAPGPTMSYYRGQEVLAPGAGWPVAPQYPPKMGPASWFRPMRTLPMEPGPGGSEGRGPEDQGPPLVWTEIAPIRPESSDSGLGEGDSKRRRVSPYPSSGDSSSPAGAPSPFDKEAEGQFYNYFPN
Uniprot:: Q9UL17
Synonyme:: T-bet;T-box 21;T-box expressed in T cells;T-box protein 21;T-box transcription factor TBX21;T-cell-specific T-box transcription factor T-bet;T-PET;TBET;TBLYM;transcription factor TBLYM
Weitere Details:: This gene is a member of a phylogenetically conserved family of genes that share a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. This gene is the human ortholog of mouse Tbx21/Tbet gene. Studies in mouse show that Tbx21 protein is a Th1 cell-specific transcription factor that controls the expression of the hallmark Th1 cytokine, interferon-gamma (IFNG). Expression of the human ortholog also correlates with IFNG expression in Th1 and natural killer cells, suggesting a role for this gene in initiating Th1 lineage development from naive Th precursor cells.

Versandbedingungen:: Blue Ice