Mouse PlGF Rabbit polyclonal antibody

Größe

£152.00

SKU:: A24547
Zusätzliche Namen:: Mouse PlGF|PIGF|Plgf
Anwendung:: ELISA, WB
Molekulargewicht:: 22kDa
Spezies-Reaktivität:: Mouse
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: ALSAGNNSTEVEVVPFNEVWGRSYCRPMEKLVYILDEYPDEVSHIFSPSCVLLSRCSGCCGDEGLHCVPIKTANITMQILKIPPNRDPHFYVEMTFSQDVLCECRPILETTKAERRKTKGKRKRSRNSQTEEPHP
Uniprot:: P49764
Synonyme:: AI854365;PI;PIGF;PL;placenta growth factor;Plgf
Weitere Details:: Predicted to enable identical protein binding activity; receptor ligand activity; and vascular endothelial growth factor receptor binding activity. Acts upstream of or within branching involved in ureteric bud morphogenesis and regulation of morphogenesis of a branching structure. Located in extracellular space. Is expressed in several structures, including brain; gut gland; musculature; reproductive system; and urinary system. Human ortholog(s) of this gene implicated in several diseases, including brain ischemia; diabetic neuropathy; glioblastoma; myocardial infarction; and pancreatic endocrine carcinoma. Orthologous to human PGF (placental growth factor).