A24545
XPNPEP3 Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A24545
- Zusätzliche Namen:
- APP3|ICP55|NPHPL1|X-prolyl aminopeptidase 3|XPNPEP3
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 57kda
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- SLQPVPERRIPNRYLGQPSPFTHPHLLRPGEVTPGLSQVEYALRRHKLMSLIQKEAQGQSGTDQTVVVLSNPTYYMSNDIPYTFHQDNNFLYLCGFQEPDSILVLQSLPGKQLPSHKAILFVPRRDPSRELWDGPRSGTDGAIALTGVDEAYTLEEFQHLLPKMKAETNMVWYDWMRPSHAQLHSDYMQPLTEAKAKSK
- Uniprot:
- Q9NQH7
- Synonyme:
- Aminopeptidase P3;APP3;ICP55;Intermediate Cleaving Peptidase 55;NPHPL1;probable Xaa-Pro aminopeptidase 3;X-Pro aminopeptidase 3;X-prolyl aminopeptidase 3, mitochondrial;xaa-Pro aminopeptidase 3
- Weitere Details:
- The protein encoded by this gene belongs to the family of X-pro-aminopeptidases that utilize a metal cofactor, and remove the N-terminal amino acid from peptides with a proline residue in the penultimate position. This protein has been shown to localize to the mitochondria of renal cells, and have a role in ciliary function. Mutations in this gene are associated with nephronophthisis-like nephropathy-1. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene, however, expression of some of these isoforms in vivo is not known.
- Versandbedingungen:
- Blue Ice



