A24539
LACTB Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A24539
- Zusätzliche Namen:
- G24|lactamase beta|LACTB|MRPL56
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 60kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- HRIKDEVGAPGIVVGVSVDGKEVWSEGLGYADVENRVPCKPETVMRIASISKSLTMVALAKLWEAGKLDLDIPVQHYVPEFPEKEYEGEKVSVTTRLLISHLSGIRHYEKDIKKVKEEKAYKALKMMKENVAFEQEKEGK
- Uniprot:
- P83111
- Synonyme:
- G24;mitochondrial 39S ribosomal protein L56;MRPL56;serine beta-lactamase-like protein LACTB, mitochondrial;serine beta-lactamase-like protein, mitochondrial
- Weitere Details:
- This gene encodes a mitochondrially-localized protein that has sequence similarity to prokaryotic beta-lactamases. Many of the residues responsible for beta-lactamase activity are not conserved in this protein, suggesting it may have a different enzymatic function. Increased expression of the related mouse gene was found to be associated with obesity. Alternative splicing results in multiple transcript variants encoding different protein isoforms.
- Versandbedingungen:
- Blue Ice