CD132 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A24525
Zusätzliche Namen:: [g]c|CD132|gamma(c)|gc|p64
Anwendung:: ELISA, WB
Molekulargewicht:: 42kda
Spezies-Reaktivität:: Mouse
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: WSSKVLMSSANEDIKADLILTSTAPEHLSAPTLPLPEVQCFVFNIEYMNCTWNSSSEPQATNLTLHYRYKVSDNNTFQECSHYLFSKEITSGCQIQKEDIQLYQTFVVQLQDPQKPQRRAVQKLNLQNLVIPRAPENLTLSNLSESQLELRWKSRHIKERCLQYLVQYRSNRDRSWTELIVNHEPRFSLPSVDELKRYTFRVRSRYNPICGSSQQWSKWSQPVHWGSHTVEENPSLFALEA
Uniprot:: P34902
Synonyme:: [g]c;CD132;common gamma chain;cytokine receptor common subunit gamma;gamm;gamma C receptor;gamma(;gamma(c);gammaC;gc;IL-2 receptor subunit gamma;IL-2R subunit gamma;interleukin-2 receptor subunit gamma;p64
Weitere Details:: This gene encodes a transmembrane protein that is a common subunit of several interleukin receptor complexes. These receptors are comprised of alpha and beta subunits in addition to this gamma subunit. Signalling through this pathway in important in immune cell differentiation and function. Alternative splicing results in multiple transcript variants.