CD134 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A24523
Zusätzliche Namen:: ACT35|CD134|Ly-70|Ox40|Txgp1|TXGP1L
Anwendung:: ELISA, WB
Molekulargewicht:: 30kDa
Spezies-Reaktivität:: Mouse
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: VTARRLNCVKHTYPSGHKCCRECQPGHGMVSRCDHTRDTLCHPCETGFYNEAVNYDTCKQCTQCNHRSGSELKQNCTPTQDTVCRCRPGTQPRQDSGYKLGVDCVPCPPGHFSPGNNQACKPWTNCTLSGKQTRHPASDSLDAVCEDRSLLATLLWETQRPTFRPTTVQSTTVWPRTSELPSPPTLVTPEGP
Uniprot:: P47741
Synonyme:: ACT3;ACT35;CD134;Ly-70;Ox4;Ox40;OX40 antigen;OX40L receptor;tax-transcriptionally activated glycoprotein 1;tumor necrosis factor receptor superfamily member 4;Txgp;Txgp1;TXGP1L
Weitere Details:: Enables tumor necrosis factor-activated receptor activity. Involved in negative regulation of apoptotic process; positive regulation of B cell proliferation; and regulation of gene expression. Acts upstream of or within several processes, including cellular defense response; negative regulation of cytokine production; and regulation of protein kinase activity. Located in external side of plasma membrane. Human ortholog(s) of this gene implicated in immunodeficiency 16. Orthologous to human TNFRSF4 (TNF receptor superfamily member 4).