C1qa Rabbit polyclonal antibody

Größe

Auf Anfrage

SKU:: A24519
Zusätzliche Namen:: Adic|C1q|C1qa
Anwendung:: ELISA, WB, IHC-P, IF, ICC
Molekulargewicht:: 30kDa
Spezies-Reaktivität:: Mouse
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: EDVCRAPNGKDGAPGNPGRPGRPGLKGERGEPGAAGIRTGIRGFKGDPGESGPPGKPGNVGLPGPSGPLGDSGPQGLKGVKGNPGNIRDQPRPAFSAIRQNPMTLGNVVIFDKVLTNQESPYQNHTGRFICAVPGFYYFNFQVISKWDLCLFIKSSSGGQPRDSLSFSNTNNKGLFQVLAGGTVLQLRRGDEVWIEKDPAKGRIYQGTEADSIFSGFLIFPSA
Uniprot:: P98086
Synonyme:: Adic;adiponectin c;AI255395;C1q;complement C1q subcomponent subunit A
Weitere Details:: Involved in several processes, including complement-mediated synapse pruning; microglial cell activation; and nervous system development. Acts upstream of or within complement activation, classical pathway. Located in postsynapse. Is expressed in brain; foot; genitourinary system; and pancreas. Used to study epilepsy and systemic lupus erythematosus. Human ortholog(s) of this gene implicated in glomerulonephritis. Orthologous to human C1QA (complement C1q A chain).