SOX13 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A24507
Zusätzliche Namen:: ICA12|Sox-13|SOX13|SRY-box 13
Anwendung:: ELISA, WB
Molekulargewicht:: 69kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: RQSYVIPPQAGQVQMSSSDVLYPRAAGMPLAQPLVEHYVPRSLDPNMPVIVNTCSLREEGEGTDDRHSVADGEMYR
Uniprot:: Q9UN79
Synonyme:: ICA12;islet cell antibody 12;islet cell antigen 12;Sox-13;SRY (sex determining region Y)-box 13;SRY-box 13;SRY-related HMG-box gene 13;transcription factor SOX-13;type 1 diabetes autoantigen ICA12
Weitere Details:: This gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins. It has also been determined to be a type-1 diabetes autoantigen, also known as islet cell antibody 12.