A24487
CD74 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A24487
- Zusätzliche Namen:
- CD74|CLIP|DHLAG|HLADG|Ia-GAMMA|Ii
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 34kda
- Spezies-Reaktivität:
- Mouse
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- QQQGRLDKLTITSQNLQLESLRMKLPKSAKPVSQMRMATPLLMRPMSMDNMLLGPVKNVTKYGNMTQDHVMHLLTRSGPLEYPQLKGTFPENLKHLKNSMDGVNWKIFESWMKQWLLFEMSKNSLEEKKPTEAPPKEPLDMEDLSSGLGVTRQELGQVTL
- Uniprot:
- P04441-2
- Synonyme:
- C;class II-associated invariant chain peptide;CLIP;DHLAG;dinucleotide microsatellite;H-2 class II histocompatibility antigen gamma chain;histocompatibility: class II antigens, gamma chain of;HLA-DR-GAMMA;HLADG;ia antigen-associated invariant chain;Ia-associated invariant chain;Ia-GAMMA;Ii;ii chain;invariant polypeptide of major histocompatibility complex, class II antigen-associated;MHC class II-associated invariant chain
- Weitere Details:
- Enables MHC class II protein binding activity; cytokine receptor activity; and nitric-oxide synthase binding activity. Contributes to cytokine binding activity. Involved in several processes, including macrophage migration inhibitory factor signaling pathway; positive regulation of macromolecule metabolic process; and regulation of signal transduction. Acts upstream of or within several processes, including antigen processing and presentation of exogenous peptide antigen via MHC class II; regulation of T cell differentiation; and thymic T cell selection. Located in several cellular components, including Golgi apparatus; external side of plasma membrane; and multivesicular body. Part of MHC class II protein complex; NOS2-CD74 complex; and macrophage migration inhibitory factor receptor complex. Is expressed in lower jaw; lower jaw incisor; lower jaw molar; and thymus primordium. Orthologous to human CD74 (CD74 molecule).
- Versandbedingungen:
- Blue Ice