CD81 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A24484
Zusätzliche Namen:: CD81|Tapa-1|Tapa1|Tspan28
Anwendung:: ELISA, WB
Molekulargewicht:: 22kDa
Spezies-Reaktivität:: Mouse
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: VAAGIWGFVNKDQIAKDVKQFYDQALQQAVMDDDANNAKAVVKTFHETLNCCGSNALTTLTTTILRNSLCPSGGNILTPLLQQDCHQKIDELFSGKLYLIGIAAIV
Uniprot:: P35762
Synonyme:: 26 kDa cell surface protein TAPA-1;CD81 antigen;CD81 antigen (target of antiproliferative antibody 1);CVID6;S5.7;Ta;Tap;Tapa-1;TAPA1;target of the antiproliferative antibody 1;tetraspanin-28;Tsp;tspan-28;TSPAN28
Weitere Details:: Predicted to enable cholesterol binding activity; signaling receptor binding activity; and virus receptor activity. Involved in several processes, including cellular response to low-density lipoprotein particle stimulus; positive regulation of immune response; and syncytium formation by plasma membrane fusion. Acts upstream of or within regulation of cell motility. Located in membrane. Is expressed in several structures, including alimentary system; extraembryonic component; genitourinary system; nervous system; and sensory organ. Human ortholog(s) of this gene implicated in common variable immunodeficiency. Orthologous to human CD81 (CD81 molecule).

Versandbedingungen:: Blue Ice