A24481
CK14 Rabbit polyclonal antibody
Größe
Auf Anfrage
- SKU:
- A24481
- Zusätzliche Namen:
- CK14|EBS3|EBS4|K14|keratin 14|KRT14|NFJ
- Anwendung:
- ELISA, WB, IF, ICC
- Molekulargewicht:
- Refer to figures
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- QIQEMIGSVEEQLAQLRCEMEQQNQEYKILLDVKTRLEQEIATYRRLLEGEDAHLSSSQFSSGSQSSRDVTSSSRQIRTKVMDVHDGKVVSTHEQVLRTKN
- Uniprot:
- P02533
- Synonyme:
- CK14;cytokeratin 14;Cytokeratin-14;EBS3;EBS4;K14;keratin 14, type I;Keratin-14;keratin, type I cytoskeletal 14;NFJ
- Weitere Details:
- This gene encodes a member of the keratin family, the most diverse group of intermediate filaments. This gene product, a type I keratin, is usually found as a heterotetramer with two keratin 5 molecules, a type II keratin. Together they form the cytoskeleton of epithelial cells. Mutations in the genes for these keratins are associated with epidermolysis bullosa simplex. At least one pseudogene has been identified at 17p12-p11.
- Versandbedingungen:
- Blue Ice