A24473
ZDHHC15 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A24473
- Zusätzliche Namen:
- DHHC15|MRX91|palmitoyltransferase ZDHHC15|ZDHHC15
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 36kda
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- FGYHCWLVSRNKTTLEAFCTPVFTSGPEKNGFNLGFIKNIQQVFGDKKKFWLIPIGSSPGDGHSFPMRSMNESQNPLLANEETWEDNEDDNQDYPEGSSSLAVETET
- Uniprot:
- Q96MV8
- Synonyme:
- acyltransferase ZDHHC15;DHHC-15;DHHC15;MRX91;palmitoyltransferase ZDHHC15;zinc finger DHHC domain-containing protein 15;zinc finger DHHC-type containing 15;zinc finger, DHHC domain containing 15
- Weitere Details:
- The protein encoded by this gene belongs to the DHHC palmitoyltransferase family. Mutations in this gene are associated with mental retardatio X-linked type 91 (MRX91). Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
- Versandbedingungen:
- Blue Ice