DYRK2 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A24467
Zusätzliche Namen:: dual specificity tyrosine-phosphorylation-regulated kinase 2|DYRK2
Anwendung:: ELISA, WB, IHC-P
Molekulargewicht:: 66kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: LKGCDDPLFLDFLKQCLEWDPAVRMTPGQALRHPWLRRRLPKPPTGEKTSVKRITESTGAITSISKLPPPSSSASKLRTNLAQMTDANGNIQQRTVLPKLV
Uniprot:: Q92630
Synonyme:: dual specificity tyrosine-(Y)-phosphorylation regulated kinase 2;dual specificity tyrosine-phosphorylation-regulated kinase 2
Weitere Details:: DYRK2 belongs to a family of protein kinases whose members are presumed to be involved in cellular growth and/or development. The family is defined by structural similarity of their kinase domains and their capability to autophosphorylate on tyrosine residues. DYRK2 has demonstrated tyrosine autophosphorylation and catalyzed phosphorylation of histones H3 and H2B in vitro. Two isoforms of DYRK2 have been isolated. The predominant isoform, isoform 1, lacks a 5' terminal insert.