A24466
NDUFS7 Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A24466
- Zusätzliche Namen:
- CI-20|CI-20KD|MY017|NADH:ubiquinone oxidoreductase core subunit S7|NDUFS7|PSST
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 20kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- WPMTFGLACCAVEMMHMAAPRYDMDRFGVVFRASPRQSDVMIVAGTLTNKMAPALRKVYDQMPEPRYVVSMGSCANGGGYY
- Uniprot:
- O75251
- Synonyme:
- CI-20;CI-20KD;complex I 20kDa subunit;complex I-20kD;complex I, mitochondrial respiratory chain, 20-KD subunit;MC1DN3;MY017;NADH dehydrogenase (ubiquinone) Fe-S protein 7, 20kDa (NADH-coenzyme Q reductase);NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial;NADH-coenzyme Q reductase;NADH-ubiquinone oxidoreductase 20 kDa subunit;NADH:ubiquinone oxidoreductase PSST subunit;PSST;PSST subunit
- Weitere Details:
- This gene encodes a protein that is a subunit of one of the complexes that forms the mitochondrial respiratory chain. This protein is one of over 40 subunits found in complex I, the nicotinamide adenine dinucleotide (NADH):ubiquinone oxidoreductase. This complex functions in the transfer of electrons from NADH to the respiratory chain, and ubiquinone is believed to be the immediate electron acceptor for the enzyme. Mutations in this gene cause Leigh syndrome due to mitochondrial complex I deficiency, a severe neurological disorder that results in bilaterally symmetrical necrotic lesions in subcortical brain regions.
- Versandbedingungen:
- Blue Ice

