XPO6 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A24463
Zusätzliche Namen:: EXP6|exportin-6|RANBP20|XPO6
Anwendung:: ELISA, WB
Molekulargewicht:: 128kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: DIGRQDWPMFYHDFFTNILQLIQSPVTTPLGLIMLKTTSEELACPREDLSVARKEELRKLLLDQVQTVLGLLTGILETVWDKHSVTAATPPPSPTSGESGD
Uniprot:: Q96QU8
Synonyme:: Activated tyrosine kinase PDGFRB;beta-type platelet-derived growth factor receptor;CD140 antigen-like family member B;CD140B;EXP6;exportin-6;IBGC4;IMF1;JTK12;KOGS;NDEL1-PDGFRB;PDGF-R-beta;PDGFR;PDGFR-1;PDGFR-beta;PDGFR1;PENTT;platelet-derived growth factor receptor 1;platelet-derived growth factor receptor beta;platelet-derived growth factor receptor, beta polypeptide;ran-binding protein 20;RANBP20
Weitere Details:: The protein encoded by this gene is a member of the importin-beta family. Members of this family are regulated by the GTPase Ran to mediate transport of cargo across the nuclear envelope. This protein has been shown to mediate nuclear export of profilin-actin complexes. A pseudogene of this gene is located on the long arm of chromosome 14. Alternative splicing results in multiple transcript variants that encode different protein isoforms.