A24462
p19ARF Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A24462
- Zusätzliche Namen:
- Arf|ARF-INK4a|INK4a-ARF|Ink4a/Arf|MTS1|p19<ARF>|p19ARF|Pctr1
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 17 kDa
- Spezies-Reaktivität:
- Mouse
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MGRRFLVTVRIQRAGRPLQERVFLVKFVRSRRPRTASCALAFVNMLLRLERILRRGPHRNPGPGDDDGQRSRSSSSAQLRCRFELRGPHYLLPPGARRSA
- Uniprot:
- Q64364
- Synonyme:
- A;alternative reading frame;ARF;ARF-;ARF-INK4a;CDK4 inhibitor p16-INK4;CDK4I;CDKN2;cell cycle negative regulator beta;CMM2;cyclin-dependent kinase 4 inhibitor A;cyclin-dependent kinase inhibitor 2A;cyclin-dependent kinase inhibitor 2A (melanoma, p16, inhibits CDK4);cyclin-dependent kinase inhibitor 2A (p16, inhibits CDK4);cyclin-dependent kinase inhibitor protein;INK4;INK4A;INK4a-ARF;Ink4a/Arf;mitochondrial smARF;MLM;MTS;MTS-1;MTS1;multiple tumor suppressor 1;p1;P14;P14ARF;P16;p16-INK4;P16-INK4A;p16(INK4a);p16I;P16INK4;P16INK4A;P19;p19<A;p19<ARF>;P19ARF;Pct;Pctr1;TP16
- Weitere Details:
- Enables MDM2/MDM4 family protein binding activity; enzyme inhibitor activity; and protein N-terminus binding activity. Involved in several processes, including negative regulation of lymphocyte proliferation; positive regulation of apoptotic process; and regulation of transcription, DNA-templated. Acts upstream of or within several processes, including negative regulation of cellular protein metabolic process; negative regulation of mammary gland epithelial cell proliferation; and positive regulation of apoptotic process involved in mammary gland involution. Located in cytoplasm and granular component. Part of protein-containing complex. Is expressed in several structures, including bone marrow; central nervous system; dorsal root ganglion; eye; and testis. Human ortholog(s) of this gene implicated in several diseases, including breast cancer (multiple); carcinoma (multiple); hematologic cancer (multiple); melanoma (multiple); and nervous system cancer (multiple). Orthologous to human CDKN2A (cyclin dependent kinase inhibitor 2A).
- Versandbedingungen:
- Blue Ice

