LGR5 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A24460
Zusätzliche Namen:: FEX|GPR49|GPR67|GRP49|HG38|LGR5
Anwendung:: ELISA, Flow Cytometry, WB
Molekulargewicht:: 102kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: CAFGVCENAYKISNQWNKGDNSSMDDLHKKDAGMFQAQDERDLEDFLLDFEEDLKALHSVQCSPSPGPFKPCEHLLDGWLIRIGVWTIAVLALTCNALVTS
Uniprot:: O75473
Synonyme:: FEX;G-protein coupled receptor 49;G-protein coupled receptor 67;G-protein coupled receptor HG38;GPR49;GPR67;GRP49;HG38;leucine-rich repeat-containing G-protein coupled receptor 5;orphan G protein-coupled receptor HG38
Weitere Details:: The protein encoded by this gene is a leucine-rich repeat-containing receptor (LGR) and member of the G protein-coupled, 7-transmembrane receptor (GPCR) superfamily. The encoded protein is a receptor for R-spondins and is involved in the canonical Wnt signaling pathway. This protein plays a role in the formation and maintenance of adult intestinal stem cells during postembryonic development. Several transcript variants encoding different isoforms have been found for this gene.