PGHS-2 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A24438
Zusätzliche Namen:: COX-2|COX2|GRIPGHS|hCox-2|PGG/HS|PGHS-2|PHS-2
Anwendung:: WB
Molekulargewicht:: 70kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: GETMVEVGAPFSLKGLMGNVICSPAYWKPSTFGGEVGFQIINTASIQSLICNNVKGCPFTSFSVPDPELIKTVTINASSSRSGLDDINPTVLLKERSTEL
Uniprot:: P35354
Synonyme:: COX-2;COX2;cyclooxygenase 2;cyclooxygenase 2b;Cyclooxygenase-2;GRIPGHS;hCox-2;PGG/HS;PGH synthase 2;PGHS-2;PHS II;PHS-2;prostaglandin G/H synthase 2;prostaglandin H2 synthase 2;Prostaglandin-endoperoxide synthase 2;prostaglandin-endoperoxide synthase 2 (prostaglandin G/H synthase and cyclooxygenase)
Weitere Details:: Prostaglandin-endoperoxide synthase (PTGS), also known as cyclooxygenase, is the key enzyme in prostaglandin biosynthesis, and acts both as a dioxygenase and as a peroxidase. There are two isozymes of PTGS: a constitutive PTGS1 and an inducible PTGS2, which differ in their regulation of expression and tissue distribution. This gene encodes the inducible isozyme. It is regulated by specific stimulatory events, suggesting that it is responsible for the prostanoid biosynthesis involved in inflammation and mitogenesis.