[KO Validated] Cytokeratin 8 Rabbit polyclonal antibody

Größe

£164.00

SKU:: A24434
Zusätzliche Namen:: 8|CARD2|CK-8|CK8|CYK8|K2C8|K8|KO
Anwendung:: WB
Molekulargewicht:: 54 kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: VKLALDIEIATYRKLLEGEESRLESGMQNMSIHTKTTSGYAGGLSSAYGGLTSPGLSYSLGSSFGSGAGSSSFSRTSSSRAVVVKKIETRDGKLVSESSDV
Uniprot:: P05787
Synonyme:: CARD2;CK-8;CK8;CYK8;cytokeratin-8;K2C8;K8;keratin 8, type II;Keratin-8;keratin, type II cytoskeletal 8;KO;type-II keratin Kb8
Weitere Details:: This gene is a member of the type II keratin family clustered on the long arm of chromosome 12. Type I and type II keratins heteropolymerize to form intermediate-sized filaments in the cytoplasm of epithelial cells. The product of this gene typically dimerizes with keratin 18 to form an intermediate filament in simple single-layered epithelial cells. This protein plays a role in maintaining cellular structural integrity and also functions in signal transduction and cellular differentiation. Mutations in this gene cause cryptogenic cirrhosis. Alternatively spliced transcript variants have been found for this gene.