Mouse G-CSF Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A24423
Zusätzliche Namen:: Csfg|G-CSF|MGI-IG|Mouse G-CSF
Anwendung:: ELISA, WB
Molekulargewicht:: 50-60kDa (Recombinant Protein)
Spezies-Reaktivität:: Mouse
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: VPLVTVSALPPSLPLPRSFLLKSLEQVRKIQASGSVLLEQLCATYKLCHPEELVLLGHSLGIPKASLSGCSSQALQQTQCLSQLHSGLCLYQGLLQALSGISPALAPTLDLLQLDVANFATTIWQQMENLGVAPTVQPTQSAMPAFTSAFQRRAGGVLAISYLQGFLETARLALHHLA
Uniprot:: P09920
Synonyme:: C17orf33;Csf;CSF3OS;Csfg;filgrastim;G-CS;G-CSF;GCSF;granulocyte colony-stimulating factor;granulocyte-colony stimulating factor;lenograstim;MGI-;MGI-IG;pluripoietin
Weitere Details:: Enables granulocyte colony-stimulating factor receptor binding activity. Acts upstream of or within positive regulation of myeloid cell differentiation. Predicted to be located in endocytic vesicle lumen and extracellular region. Predicted to be active in extracellular space. Is expressed in several structures, including brain; dorsal aorta; liver; reproductive system; and yolk sac. Human ortholog(s) of this gene implicated in several diseases, including allergic cutaneous vasculitis; artery disease (multiple); ischemia (multiple); leukemia (multiple); and lung disease (multiple). Orthologous to human CSF3 (colony stimulating factor 3).

Versandbedingungen:: Blue Ice