A24351
C4c Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A24351
- Zusätzliche Namen:
- C4B_2|C4B1|C4B12|C4B2|C4B3|C4B5|C4BD|C4c|C4F|CH|CO4|CPAMD3
- Anwendung:
- ELISA, WB, IF, ICC
- Molekulargewicht:
- 85kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- NGFKSHALQLNNRQIRGLEEELQFSLGSKINVKVGGNSKGTLKVLRTYNVLDMKNTTCQDLQIEVTVKGHVEYTMEANEDYEDYEYDELPAKDDPDAPLQPVTPLQLFEG
- Uniprot:
- P0C0L5
- Synonyme:
- basic complement C4;C3 and PZP-like alpha-2-macroglobulin domain-containing protein 3;C4B_2;C4B1;C4B12;C4B2;C4B3;C4B5;C4BD;C4F;CH;Chido form of C4;CO4;complement C4-B;complement C4-B-like;complement C4B1a;complement component 4B (Chido blood group);CPAMD3
- Weitere Details:
- This gene encodes the basic form of complement factor 4, and together with the C4A gene, is part of the classical activation pathway. The protein is expressed as a single chain precursor which is proteolytically cleaved into a trimer of alpha, beta, and gamma chains prior to secretion. The trimer provides a surface for interaction between the antigen-antibody complex and other complement components. The alpha chain may be cleaved to release C4 anaphylatoxin, a mediator of local inflammation. Deficiency of this protein is associated with systemic lupus erythematosus. This gene localizes to the major histocompatibility complex (MHC) class III region on chromosome 6. Varying haplotypes of this gene cluster exist, such that individuals may have 1, 2, or 3 copies of this gene. In addition, this gene exists as a long form and a short form due to the presence or absence of a 6.4 kb endogenous HERV-K retrovirus in intron 9.
- Versandbedingungen:
- Blue Ice





