A24339
Fos B Rabbit monoclonal antibody

Größe
Auf Anfrage
- SKU:
- A24339
- Zusätzliche Namen:
- AP-1|Fos B|G0S3|GOS3|GOSB
- Anwendung:
- ELISA, WB, IHC-P
- Molekulargewicht:
- 38kDa/48kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MFQAFPGDYDSGSRCSSSPSAESQYLSSVDSFGSPPTAAASQECAGLGEMPGSFVPTVTAITTSQDLQWLVQPTLISSMAQSQGQPLASQPPVVDPYDMP
- Uniprot:
- P53539
- Synonyme:
- activator protein 1;AP-1;FBJ murine osteosarcoma viral oncogene homolog B;FosB proto-oncogene, AP-1 trancription factor subunit;G0/G1 switch regulatory protein 3;G0S3;GOS3;GOSB;protein fosB
- Weitere Details:
- The Fos gene family consists of 4 members: FOS, FOSB, FOSL1, and FOSL2. These genes encode leucine zipper proteins that can dimerize with proteins of the JUN family, thereby forming the transcription factor complex AP-1. As such, the FOS proteins have been implicated as regulators of cell proliferation, differentiation, and transformation. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
- Versandbedingungen:
- Blue Ice





