A24338
CD84 Rabbit monoclonal antibody

Größe
Auf Anfrage
- SKU:
- A24338
- Zusätzliche Namen:
- CD84|hCD84|LY9B|mCD84|SLAMF5
- Anwendung:
- ELISA, Flow Cytometry, WB, IF, ICC
- Molekulargewicht:
- 64-82kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- KDSEIFTVNGILGESVTFPVNIQEPRQVKIIAWTSKTSVAYVTPGDSETAPVVTVTHRNYYERIHALGPNYNLVISDLRMEDAGDYKADINTQADPYTTTKRYNLQIYRRLGKPKITQSLMASVNSTCNVTLTCSVEKEEKNVTYNWSPLGEEGNVLQIFQTPEDQELTYTCTAQNPVSNNSDSISARQLCADIAMGFRTHHTG
- Uniprot:
- Q9UIB8
- Synonyme:
- CD84 antigen (leukocyte antigen);cell surface antigen MAX.3;hCD84;hly9-beta;leucocyte differentiation antigen CD84;leukocyte antigen CD84;leukocyte differentiation antigen CD84;LY9B;mCD84;signaling lymphocytic activation molecule 5;SLAM family member 5;SLAMF5
- Weitere Details:
- This gene encodes a membrane glycoprotein that is a member of the signaling lymphocyte activation molecule (SLAM) family. This family forms a subset of the larger CD2 cell-surface receptor Ig superfamily. The encoded protein is a homophilic adhesion molecule that is expressed in numerous immune cells types and is involved in regulating receptor-mediated signaling in those cells. Alternate splicing results in multiple transcript variants.
- Versandbedingungen:
- Blue Ice







