CD84 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A24338
Zusätzliche Namen:: CD84|hCD84|LY9B|mCD84|SLAMF5
Anwendung:: ELISA, Flow Cytometry, WB, IF, ICC
Molekulargewicht:: 64-82kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: KDSEIFTVNGILGESVTFPVNIQEPRQVKIIAWTSKTSVAYVTPGDSETAPVVTVTHRNYYERIHALGPNYNLVISDLRMEDAGDYKADINTQADPYTTTKRYNLQIYRRLGKPKITQSLMASVNSTCNVTLTCSVEKEEKNVTYNWSPLGEEGNVLQIFQTPEDQELTYTCTAQNPVSNNSDSISARQLCADIAMGFRTHHTG
Uniprot:: Q9UIB8
Synonyme:: CD84 antigen (leukocyte antigen);cell surface antigen MAX.3;hCD84;hly9-beta;leucocyte differentiation antigen CD84;leukocyte antigen CD84;leukocyte differentiation antigen CD84;LY9B;mCD84;signaling lymphocytic activation molecule 5;SLAM family member 5;SLAMF5
Weitere Details:: This gene encodes a membrane glycoprotein that is a member of the signaling lymphocyte activation molecule (SLAM) family. This family forms a subset of the larger CD2 cell-surface receptor Ig superfamily. The encoded protein is a homophilic adhesion molecule that is expressed in numerous immune cells types and is involved in regulating receptor-mediated signaling in those cells. Alternate splicing results in multiple transcript variants.