Collagen II Rabbit polyclonal antibody

Größe

£152.00

SKU:: A24334
Zusätzliche Namen:: ANFH|AOM|COL11A3|Collagen II|SEDC|STL1
Anwendung:: ELISA, WB, IP
Molekulargewicht:: 36 kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 0.09% sodium azide. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: PGPKGQKGEPGDIKDIVGPKGPPGPQGPAGEQGPRGDRGDKGEKGAPGPRGRDGEPGTPGNPGPPGPPGPPGPPGLGGNFAAQMAGGFDEKAGGAQLGVMQ
Uniprot:: P02458
Synonyme:: alpha-1 type II collagen;ANFH;AOM;arthroophthalmopathy, progressive (Stickler syndrome);cartilage collagen;chondrocalcin;COL11A3;collagen alpha-1(II) chain;collagen II, alpha-1 polypeptide;collagen, type II, alpha 1;SEDC;STL1
Weitere Details:: This gene encodes the alpha-1 chain of type II collagen, a fibrillar collagen found in cartilage and the vitreous humor of the eye. Mutations in this gene are associated with achondrogenesis, chondrodysplasia, early onset familial osteoarthritis, SED congenita, Langer-Saldino achondrogenesis, Kniest dysplasia, Stickler syndrome type I, and spondyloepimetaphyseal dysplasia Strudwick type. In addition, defects in processing chondrocalcin, a calcium binding protein that is the C-propeptide of this collagen molecule, are also associated with chondrodysplasia. There are two transcripts identified for this gene.