NLRP3 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A24294
Zusätzliche Namen:: AGTAVPRL|AII/AVP|Cias1|FCAS|FCU|Mmig1|MWS|NALP3|NLRP3|Pypaf1
Anwendung:: ELISA, WB, IF, ICC, IP
Molekulargewicht:: 118kDa
Spezies-Reaktivität:: Mouse
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MTSVRCKLAQYLEDLEDVDLKKFKMHLEDYPPEKGCIPVPRGQMEKADHLDLATLMIDFNGEEKAWAMAVWIFAAINRRDLWEKAKKDQPEWNDTCTSHSSMVCQEDSLEEEWMGLLGYLSRISICKKKKDYCKMYRRHVRSRFYSIKDR
Uniprot:: Q8R4B8
Synonyme:: AGTAVPRL;AII;AII/AVP;AVP;C1orf7;caterpiller protein 1.1;Ci;CIAS1;CLR1.1;cold autoinflammatory syndrome 1 protein;cold autoinflammatory syndrome 1 protein homolog;cold-induced autoinflammatory syndrome 1 protein;cry;cryopyrin;cryopyrin, NACHT, LRR and PYD domains - containing protein 3;deafness, autosomal dominant 34;DFNA34;FCAS;FCAS1;FCU;KEFH;mast cell maturation-associated-inducible protein 1;Mmig;Mmig1;MWS;N;NACHT domain-, leucine-rich repeat-, and PYD-containing protein 3;NACHT, LRR and PYD containing protein 3;NACHT, LRR and PYD domains-containing protein 3;NACHT/LRR/pyrin domain-containing protein 3;NALP3;nucleotide-binding oligomerization domain, leucine rich repeat and pyrin domain containing 3;Pyp;PYPAF1;PYRIN-containing APAF1-like protein 1
Weitere Details:: Enables DNA-binding transcription factor binding activity and sequence-specific DNA binding activity. Involved in several processes, including positive regulation of T-helper cell differentiation; positive regulation of cytokine production; and response to bacterium. Acts upstream of or within several processes, including NLRP3 inflammasome complex assembly; activation of cysteine-type endopeptidase activity involved in apoptotic process; and defense response to virus. Located in cytoplasm and nucleus. Part of NLRP3 inflammasome complex. Is expressed in central nervous system and retina. Used to study CINCA Syndrome; familial cold autoinflammatory syndrome 1; and non-alcoholic fatty liver disease. Human ortholog(s) of this gene implicated in CINCA Syndrome; Muckle-Wells syndrome; autosomal dominant nonsyndromic deafness 34; familial cold autoinflammatory syndrome 1; and urticaria. Orthologous to human NLRP3 (NLR family pyrin domain containing 3).

Versandbedingungen:: Blue Ice