SQLE Rabbit polyclonal antibody

Größe

£152.00

SKU:: A2428
Zusätzliche Namen:: SQLE
Anwendung:: ELISA, WB, IHC-P, IF, ICC
Molekulargewicht:: 50-64 kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: VSVSSHFVGFLMKNAPQFKANHAELILANPSPVLIYQISSSETRVLVDIRGEMPRNLREYMVEKIYPQIPDHLKEPFLEATDNSHLRSMPASFLPPSSVKK
Uniprot:: Q14534
Synonyme:: SE;Squalene epoxidase;squalene monooxygenase
Weitere Details:: Enables FAD binding activity and squalene monooxygenase activity. Involved in lipid droplet formation; regulation of cell population proliferation; and sterol biosynthetic process. Located in intracellular membrane-bounded organelle. Is integral component of membrane.