PE Rabbit anti-Human CD62L/L-Selectin monoclonal antibody

Größe

Auf Anfrage

SKU:: A24249
Zusätzliche Namen:: CD62L|L-selectin|LAM1|LECAM1|LEU8|LNHR|LSEL|LYAM1|PLNHR|SELL|TQ1
Anwendung:: Flow Cytometry
Molekulargewicht:: Refer to figures
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: 2-8[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: WTYHYSEKPMNWQRARRFCRDNYTDLVAIQNKAEIEYLEKTLPFSRSYYWIGIRKIGGIWTWVGTNKSLTEEAENWGDGEPNNKKNKEDCVEIYIKRNKDAGKWNDDACHKLKAALCYTASCQPWSCSGHGECVEIINNYTCNCDVGYYGPQCQFVIQCEPLEAPELGTMDCTHPLGNFSFSSQCAFSCSEGTNLTGIEETTCGPFGNWSSPEPTCQVIQCEPLSAPDLGIMNCSHPLASFSFTSACTFICSEGTELIGKKKTICESSGIWSNPSPICQKLDKSFSMIKEGDYN
Uniprot:: P14151
Synonyme:: CD62 antigen-like family member L;CD62L;gp90-MEL;L-selectin;LAM1;LECAM1;LEU8;Leukocyte adhesion molecule 1;leukocyte surface antigen Leu-8;leukocyte-endothelial cell adhesion molecule 1;LNHR;LSEL;LYAM1;lymph node homing receptor;lymphocyte adhesion molecule 1;pln homing receptor;PLNHR;TQ1
Weitere Details:: This gene encodes a cell surface adhesion molecule that belongs to a family of adhesion/homing receptors. The encoded protein contains a C-type lectin-like domain, a calcium-binding epidermal growth factor-like domain, and two short complement-like repeats. The gene product is required for binding and subsequent rolling of leucocytes on endothelial cells, facilitating their migration into secondary lymphoid organs and inflammation sites. Single-nucleotide polymorphisms in this gene have been associated with various diseases including immunoglobulin A nephropathy. Alternatively spliced transcript variants have been found for this gene.

Versandbedingungen:: Blue Ice