A24207
PPBP Rabbit monoclonal antibody
Größe
Auf Anfrage
- SKU:
- A24207
- Zusätzliche Namen:
- B-TG1|Beta-TG|CTAP-III|CTAP3|CTAPIII|CXCL7|LA-PF4|LDGF|MDGF|NAP-2|PBP|PPBP|SCYB7|TC1|TC2|TGB|TGB1|THBGB|THBGB1
- Anwendung:
- ELISA, WB, IF, ICC
- Molekulargewicht:
- 14kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- AELRCMCIKTTSGIHPKNIQSLEVIGKGTHCNQVEVIATLKDGRKICLDPDAPRIKKIVQKKLAGDESAD
- Uniprot:
- P02775
- Synonyme:
- B-TG1;Beta-TG;beta-thromboglobulin;C-X-C motif chemokine 7;chemokine (C-X-C motif) ligand 7;connective tissue-activating peptide III;CTAP-III;CTAP3;CTAPIII;CXC chemokine ligand 7;CXCL7;LA-PF4;LDGF;leukocyte-derived growth factor;low-affinity platelet factor IV;macrophage-derived growth factor;MDGF;NAP-2;neutrophil-activating peptide 2;PBP;platelet basic protein;SCYB7;small inducible cytokine B7;small inducible cytokine subfamily B, member 7;Small-inducible cytokine B7;TC1;TC2;TGB;TGB1;THBGB;THBGB1;thrombocidin 1;thrombocidin 2;thromboglobulin, beta-1
- Weitere Details:
- The protein encoded by this gene is a platelet-derived growth factor that belongs to the CXC chemokine family. This growth factor is a potent chemoattractant and activator of neutrophils. It has been shown to stimulate various cellular processes including DNA synthesis, mitosis, glycolysis, intracellular cAMP accumulation, prostaglandin E2 secretion, and synthesis of hyaluronic acid and sulfated glycosaminoglycan. It also stimulates the formation and secretion of plasminogen activator by synovial cells. The protein also is an antimicrobial protein with bactericidal and antifungal activity.
- Versandbedingungen:
- Blue Ice