A2418
Alpha Fodrin Rabbit monoclonal antibody
Größe
Auf Anfrage
- SKU:
- A2418
- Zusätzliche Namen:
- Alpha Fodrin|DEE5|EIEE5|NEAS|SPTA2
- Anwendung:
- ELISA, WB, IHC-P
- Molekulargewicht:
- 170kDa/280kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MDPSGVKVLETAEDIQERRQQVLDRYHRFKELSTLRRQKLEDSYRFQFFQRDAEELEKWIQEKLQIASDENYKDPTNLQGKLQKHQAFEAEVQANSGAIV
- Uniprot:
- Q13813
- Synonyme:
- alpha-fodrin;alpha-II spectrin;DEE5;EIEE5;epididymis secretory sperm binding protein;fodrin alpha chain;NEAS;spectrin alpha chain, non-erythrocytic 1;spectrin, non-erythroid alpha chain;spectrin, non-erythroid alpha subunit;SPTA2
- Weitere Details:
- Spectrins are a family of filamentous cytoskeletal proteins that function as essential scaffold proteins that stabilize the plasma membrane and organize intracellular organelles. Spectrins are composed of alpha and beta dimers that associate to form tetramers linked in a head-to-head arrangement. This gene encodes an alpha spectrin that is specifically expressed in nonerythrocytic cells. The encoded protein has been implicated in other cellular functions including DNA repair and cell cycle regulation. Mutations in this gene are the cause of early infantile epileptic encephalopathy-5. Alternate splicing results in multiple transcript variants.
- Versandbedingungen:
- Blue Ice