[KD Validated] MGEA5/OGA Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A24124
Zusätzliche Namen:: MEA5|MGEA5|NCOAT
Anwendung:: ELISA, WB, IHC-P
Molekulargewicht:: 138 kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: YQEPIMSQGAALSGEPTTLTKEEEKKQPDEEPMDMVVEKQEETDHKNDNQILSEIVEAKMAEELKPMDTDKESIAESKSPEMSMQEDCISDIAPMQTDEQTNKEQFVPGPNEKPLYTAEPVTLEDLQLLADLFYLPYEHGPKGAQMLREFQWLRANSSVVSVNCKGKDSEKIEEWRSRAAKFEEMCGLVMGMFTRLSNCAN
Uniprot:: O60502
Synonyme:: beta-hexosaminidase;beta-N-acetylglucosaminidase;beta-N-acetylhexosaminidase;bifunctional protein NCOAT;hyaluronidase in meningioma;MEA5;meningioma expressed antigen 5 (hyaluronidase);meningioma-expressed antigen 5;MGEA5;N-acetyl-beta-D-glucosaminidase;N-acetyl-beta-glucosaminidase;NCOAT;nuclear cytoplasmic O-GlcNAcase and acetyltransferase;protein O-GlcNAcase
Weitere Details:: The dynamic modification of cytoplasmic and nuclear proteins by O-linked N-acetylglucosamine (O-GlcNAc) addition and removal on serine and threonine residues is catalyzed by OGT (MIM 300255), which adds O-GlcNAc, and MGEA5, a glycosidase that removes O-GlcNAc modifications (Gao et al., 2001 [PubMed 11148210]).