TAP2 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A24123
Zusätzliche Namen:: ABC18|ABCB3|APT2|D6S217E|PSF-2|PSF2|RING11|TAP2
Anwendung:: ELISA, WB, IF, ICC
Molekulargewicht:: 70kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: PNLPSPGTLAPTTLQGVVKFQDVSFAYPNRPDRPVLKGLTFTLRPGEVTALVGPNGSGKSTVAALLQNLYQPTGGQVLLDEKPISQYEHCYLHSQVVSVGQEPVLFSGSVRNNIAYGLQSCEDDKVMAAAQAAHADDFIQEMEHGIYTDVGEKGSQLAAGQKQRLAIARALVRDPRVLILDEATSALDVQCEQALQDWNSRGDRTVLVIAHRLQTVQRAHQILVLQEGKLQKLAQL
Uniprot:: Q03519
Synonyme:: ABC transporter, MHC 2;ABC18;ABCB3;antigen peptide transporter 2;APT2;ATP-binding cassette sub-family B member 3;ATP-binding cassette, sub-family B (MDR/TAP), member 3;D6S217E;peptide supply factor 2;peptide transporter involved in antigen processing 2;peptide transporter PSF2;Peptide transporter TAP2;PSF-2;PSF2;really interesting new gene 11 protein;RING11;transporter 2, ABC (ATP binding cassette);transporter 2, ATP-binding cassette, sub-family B (MDR/TAP)
Weitere Details:: The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MDR/TAP subfamily. Members of the MDR/TAP subfamily are involved in multidrug resistance. This gene is located 7 kb telomeric to gene family member ABCB2. The protein encoded by this gene is involved in antigen presentation. This protein forms a heterodimer with ABCB2 in order to transport peptides from the cytoplasm to the endoplasmic reticulum. Mutations in this gene may be associated with ankylosing spondylitis, insulin-dependent diabetes mellitus, and celiac disease. Alternative splicing of this gene produces products which differ in peptide selectivity and level of restoration of surface expression of MHC class I molecules.

Versandbedingungen:: Blue Ice