A2412
DNA Polymerase beta Rabbit monoclonal antibody
Größe
Auf Anfrage
- SKU:
- A2412
- Zusätzliche Namen:
- DNA polymerase beta|POLB
- Anwendung:
- ELISA, WB, IHC-P
- Molekulargewicht:
- 42kda
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MGVCQLPSKNDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE
- Uniprot:
- P06746
- Synonyme:
- DNA pol beta;DNA polymerase beta;DNA polymerase beta subunit;polymerase (DNA directed), beta;polymerase (DNA) beta
- Weitere Details:
- The protein encoded by this gene is a DNA polymerase involved in base excision and repair, also called gap-filling DNA synthesis. The encoded protein, acting as a monomer, is normally found in the cytoplasm, but it translocates to the nucleus upon DNA damage. Several transcript variants of this gene exist, but the full-length nature of only one has been described to date.
- Versandbedingungen:
- Blue Ice