ALPK1 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A24028
Zusätzliche Namen:: 8430410J10Rik|ALPK1|LAK|ROSAH
Anwendung:: WB
Molekulargewicht:: 150kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MNNQKVVAVLLQECKQVLDQLLLEAPDVSEEDKSEDQRCRALLPSELRTLIQEAKEMKWPFVPEKWQYKQAVGPEDKTNLKDVIGAGLQQLLASLRASILARDCAAAAAIVFLVDRFLYGLDVSGKLLQVAKGLHKLQPATPIAPQVVIRQARISVNSGKLLKAEYILSSLISNNGATGTWLYRNESDKVLVQSVCIQIRGQILQKLGMWYEAAELIWASIVGYLALPQPDKKGLSTSLGILADIFVSMSKNDYEKFKNNPQINLSLLKEFDHHLLSAAEACKLAAAFSAYTPLFVLTAVNIRGTCLLSYSSSNDCPPELKNLHLCEAKEAFEIGLLTKRDDEPVTGKQELHSFVKAAFGLTTVHRRLHGETGTVHAASQLCKEAMGKLYNFSTSSRSQDREALSQEVMSVIAQVKEHLQVQSFSNVDDRSYVPESFECRLDKLILHGQGDFQKILDTYSQHHTSVCEVFESD
Uniprot:: Q96QP1
Synonyme:: 8430410J10Rik;alpha-protein kinase 1;chromosome 4 kinase;LAK;lymphocyte alpha-kinase;lymphocyte alpha-protein kinase;ROSAH
Weitere Details:: Alpha-protein kinase 1, also known as alpha-kinase 1 (ALPK1), is associated with chronic kidney disease (CKD), myocardial infarction, gout and type 2 diabetes mellitus (DM). ALPK1 mutant has been reported to cause severe defects in motor co-ordination in mice. ALPK1 enhances the expression of proinflammatory cytokines including IL-1B Beta, IL-8 and TGF-B Beta1 in cultured human THP1 and human embryonic kidney 293 (HEK293) cells . ALPK1 short isoform (108 kDa) was highly expressed in brain, spinal cord, heart, lung, spleen, thymus, small intestine, skin and testis, while detectable inskeletal muscle and kidney. ALPK1 large isoform (130 kDa) appeared in heart, lung, thymus and skin.

Versandbedingungen:: Blue Ice