[KD Validated] TIFAB Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A24024
Anwendung:: ELISA, WB
Molekulargewicht:: 18kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: PYLEKGSALLAFCLKALSRKGCVWVNGLTLRYLEQVPLSTVNRVSFSGIQMLVRVEEGTSLEAFVCYFHVSPSPLIYRPEAEETDEWEGISQGQPPPGSG
Uniprot:: Q6ZNK6
Synonyme:: TIFA-like protein;TIFA-related protein TIFAB;TRAF-interacting protein with FHA domain-containing protein B;TRAF-interacting protein with forkhead-associated domain, family member B
Weitere Details:: TIFAB binds to TIFA (MIM 609028) and inhibits TIFA mediated NF kappa-B (NFKB1; MIM 164011) activation.