[KD Validated] NUR77 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A24016
Zusätzliche Namen:: [KD Validated] NUR77|GFRP1|HMR|N10|NAK-1|NGFIB|NP10|NUR77|TR3
Anwendung:: ELISA, WB
Molekulargewicht:: 64kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: PSLAQSPLKLFPSQATHQLGEGESYSMPTAFPGLAPTSPHLEGSGILDTPVTSTKARSGAPGGSEGRCAVCGDNASCQHYGVRTCEGCKGFFKRTVQKNAK
Uniprot:: P22736
Synonyme:: early response protein NAK1;GFRP1;growth factor-inducible nuclear protein N10;HMR;hormone receptor;N10;NAK-1;nerve growth factor IB nuclear receptor variant 1;NGFIB;NP10;nuclear hormone receptor NUR/77;nuclear receptor subfamily 4 group A member 1;NUR77;orphan nuclear receptor HMR;orphan nuclear receptor TR3;ST-59;steroid receptor TR3;testicular receptor 3;TR3;TR3 orphan receptor
Weitere Details:: This gene encodes a member of the steroid-thyroid hormone-retinoid receptor superfamily. Expression is induced by phytohemagglutinin in human lymphocytes and by serum stimulation of arrested fibroblasts. The encoded protein acts as a nuclear transcription factor. Translocation of the protein from the nucleus to mitochondria induces apoptosis. Multiple transcript variants encoding different isoforms have been found for this gene.