A24008
Collagen IV Rabbit monoclonal antibody
Größe
Auf Anfrage
- SKU:
- A24008
- Zusätzliche Namen:
- ATS2|BFH|BFH1|CA44|Collagen IV
- Anwendung:
- ELISA, WB, Dot blot
- Molekulargewicht:
- 164 kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- AQAVAVHSQDQSIPPCPQTWRSLWIGYSFLMHTGAGDQGGGQALMSPGSCLEDFRAAPFLECQGRQGTCHFFANKYSFWLTTVKADLQFSSAPAPDTLKESQAQRQKISRCQVCVKYS
- Uniprot:
- P02462, P08572, P53420, Q14031
- Synonyme:
- arresten;ATS2;BFH;BSVD;BSVD1;BSVD2;CA44;canstatin;COL4A1 NC1 domain;COL4A1s;collagen alpha-1(IV) chain;collagen alpha-2(IV) chain;collagen alpha-4(IV) chain;collagen alpha-6(IV) chain;collagen IV, alpha-1 polypeptide;Collagen IV, alpha-4 polypeptide;collagen IV, alpha-6 polypeptide;collagen of basement membrane, alpha-1 chain;collagen of basement membrane, alpha-4 chain;collagen of basement membrane, alpha-6;collagen, type IV, alpha 4;collagen, type IV, alpha 6;CXDELq22.3;DELXq22.3;DFNX6;dJ889N15.4 (Collagen Alpha 6(IV));ICH;PADMAL;POREN2;RATOR
- Weitere Details:
- This gene encodes one of the six subunits of type IV collagen, the major structural component of basement membranes. This particular collagen IV subunit, however, is only found in a subset of basement membranes. Like the other members of the type IV collagen gene family, this gene is organized in a head-to-head conformation with another type IV collagen gene so that each gene pair shares a common promoter. Mutations in this gene are associated with type II autosomal recessive Alport syndrome (hereditary glomerulonephropathy) and with familial benign hematuria (thin basement membrane disease). Two transcripts, differing only in their transcription start sites, have been identified for this gene and, as is common for collagen genes, multiple polyadenylation sites are found in the 3' UTR.
- Versandbedingungen:
- Blue Ice