IL9 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A24007
Zusätzliche Namen:: HP40|IL-9|IL9|P40
Anwendung:: ELISA, Flow Cytometry, WB
Molekulargewicht:: 19kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: QGCPTLAGILDINFLINKMQEDPASKCHCSANVTSCLCLGIPSDNCTRPCFSERLSQMTNTTMQTRYPLIFSRVKKSVEVLKNNKCPYFSCEQPCNQTTAGNALTFLKSLLEIFQKEKMRGMRGKI
Uniprot:: P15248
Synonyme:: cytokine P40;homolog of mouse T cell and mast cell growth factor 40;HP40;IL-9;interleukin-9;P40;p40 cytokine;p40 T-cell and mast cell growth factor;T-cell growth factor p40
Weitere Details:: The protein encoded by this gene is a cytokine that acts as a regulator of a variety of hematopoietic cells. This cytokine stimulates cell proliferation and prevents apoptosis. It functions through the interleukin 9 receptor (IL9R), which activates different signal transducer and activator (STAT) proteins and thus connects this cytokine to various biological processes. The gene encoding this cytokine has been identified as a candidate gene for asthma. Genetic studies on a mouse model of asthma demonstrated that this cytokine is a determining factor in the pathogenesis of bronchial hyperresponsiveness.