SHB Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A24000
Zusätzliche Namen:: bA3J10.2|SHB
Anwendung:: ELISA, WB
Molekulargewicht:: 55 kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: IWYHGAISRGDAENLLRLCKECSYLVRNSQTSKHDYSLSLRSNQGFMHMKLAKTKEKYVLGQNSPPFDSVPEVIHYYTTRKLPIKGAEHLSLLYPVAVRTL
Uniprot:: Q15464
Synonyme:: bA3J10.2;SH2 domain-containing adapter protein B;SHB (Src homology 2 domain containing) adaptor protein B;SHB adaptor protein (a Src homology 2 protein);Src homology 2 domain containing adaptor protein B
Weitere Details:: Enables phosphotyrosine residue binding activity. Predicted to be involved in several processes, including angiogenesis; apoptotic process; and signal transduction. Predicted to act upstream of or within several processes, including hematopoietic stem cell proliferation; negative regulation of oocyte maturation; and positive regulation of immune response. Located in cytoplasmic ribonucleoprotein granule; cytosol; and nucleoplasm.