PLGF Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A2400
Zusätzliche Namen:: D12S1900|PGFL|PIGF|PLGF|PlGF-2|SHGC-10760
Anwendung:: ELISA, WB, IF
Molekulargewicht:: 25 kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MPVMRLFPCFLQLLAGLALPAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVDVVSEYPSEVEHMFSPSCVSLLRCTGCCGDENLHCVPVETA
Uniprot:: P49763
Synonyme:: D12S1900;PGFL;PIGF;placenta growth factor;placental growth factor, vascular endothelial growth factor-related protein;PLGF;PlGF-2;SHGC-10760
Weitere Details:: Enables growth factor activity. Involved in positive regulation of cell population proliferation. Predicted to be located in extracellular region. Predicted to be active in extracellular space. Implicated in several diseases, including brain ischemia; diabetic neuropathy; glioblastoma; myocardial infarction; and pancreatic endocrine carcinoma. Biomarker of several diseases, including artery disease (multiple); autoimmune disease of musculoskeletal system (multiple); epilepsy (multiple); limited scleroderma; and pancreatic endocrine carcinoma.