WNT2 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A23997
Zusätzliche Namen:: INT1L1|IRP|WNT2
Anwendung:: ELISA, WB
Molekulargewicht:: 42kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: GDYLWRKYNGAIQVVMNQDGTGFTVANERFKKPTKNDLVYFENSPDYCIRDREAGSLGTAGRVCNLTSRGMDSCEVMCCGRGYDTSHVTRMTKCGCKFHW
Uniprot:: P09544
Synonyme:: epididymis secretory sperm binding protein;int-1-like protein 1;Int-1-related protein;INT1L1;IRP;protein Wnt-2;secreted growth factor;wingless-type MMTV integration site family member 2
Weitere Details:: This gene is a member of the WNT gene family. The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. Alternatively spliced transcript variants have been identified for this gene.